Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G260210_circ_g.3 |
| ID in PlantcircBase | csa_circ_001745 |
| Alias | Chr3:16166512_16167135 |
| Organism | Cucumis sativus |
| Position | chrChr3: 16166512-16167135 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa3G260210 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Chr3_circ_ig.56 Chr3_circ_ig.57 Chr3_circ_ig.58 Csa3G260210_circ_g.1 Csa3G260210_circ_g.2 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa3G260210.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.492521448 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16167074-16166801(-) |
| Potential amino acid sequence |
MPLDVRPRCIKLRQDSSEGLYFVALKGRGNEGLKSAKMMSLKAISIQALSPKKILILDSVGDLH LLHIANTANGFDFSCNIRPLPHLMKAQMLTSFPDTIISFPYMARNWVLKVPSFGLFHKDASRC* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to salt stress in root |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |