Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0669400_circ_g.8 |
| ID in PlantcircBase | osa_circ_031923 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 27726325-27727467 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0669400 |
| Parent gene annotation |
Similar to Cell division protease ftsH homolog 2, chloroplastic. (Os06t0669400-01);Similar to Cell division protease ftsH homolo g 2, chloroplastic. (Os06t0669400-02);Similar to ATP-dependent z inc metalloprotease FTSH 2, chloroplastic. (Os06t0669400-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0669400_circ_g.1 Os06g0669400_circ_g.2 Os06g0669400_circ_g.3 Os06g0669400_circ_g.4 Os06g0669400_circ_g.5 Os06g0669400_circ_g.6 Os06g0669400_circ_g.7 Os06g0669400_circ_g.9 Os06g0669400_circ_g.10 Os06g0669400_circ_g.11 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0669400-02:1 Os06t0669400-01:1 Os06t0669400-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.651524825 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27727443-27726442(+) 27726427-27727442(-) |
| Potential amino acid sequence |
MDVGAIFAHCLSKRPGLSKAESRISALLVAAITMIPVFPSKPSISVSN*(+) MVLRGTLESLLLLPPTGLISWILLYSDLDVLTDSERRWLQHP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |