Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0669400_circ_g.8 |
ID in PlantcircBase | osa_circ_031923 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 27726325-27727467 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0669400 |
Parent gene annotation |
Similar to Cell division protease ftsH homolog 2, chloroplastic. (Os06t0669400-01);Similar to Cell division protease ftsH homolo g 2, chloroplastic. (Os06t0669400-02);Similar to ATP-dependent z inc metalloprotease FTSH 2, chloroplastic. (Os06t0669400-03) |
Parent gene strand | - |
Alternative splicing | Os06g0669400_circ_g.1 Os06g0669400_circ_g.2 Os06g0669400_circ_g.3 Os06g0669400_circ_g.4 Os06g0669400_circ_g.5 Os06g0669400_circ_g.6 Os06g0669400_circ_g.7 Os06g0669400_circ_g.9 Os06g0669400_circ_g.10 Os06g0669400_circ_g.11 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0669400-02:1 Os06t0669400-01:1 Os06t0669400-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.651524825 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27727443-27726442(+) 27726427-27727442(-) |
Potential amino acid sequence |
MDVGAIFAHCLSKRPGLSKAESRISALLVAAITMIPVFPSKPSISVSN*(+) MVLRGTLESLLLLPPTGLISWILLYSDLDVLTDSERRWLQHP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |