Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G19820_circ_g.3 |
ID in PlantcircBase | ath_circ_039328 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 6697097-6697445 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT5G19820 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | - |
Alternative splicing | AT5G19820_circ_g.1 AT5G19820_circ_g.2 AT5G19820_circ_g.4 AT5G19820_circ_g.5 AT5G19820_circ_g.6 AT5G19820_circ_g.7 AT5G19820_circ_g.8 AT5G19820_circ_g.9 AT5G19820_circ_g.10 AT5G19820_circ_g.11 AT5G19820_circ_g.12 AT5G19820_circ_g.13 AT5G19820_circ_g.14 AT5G19820_circ_g.15 AT5G19820_circ_g.16 AT5G19820_circ_g.17 AT5G19820_circ_g.18 |
Support reads | 20 |
Tissues | root, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G19820.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.397743522 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6697383-6697099(-) |
Potential amino acid sequence |
MTASSSRKRERGERAHAEDFDAEEGELIKEENEQEEEIFDQVGEILGTLVKTFKASFLPFFDEL SSYLTPMWISGNLLDEGKIRSIVDEIKQVMTASSSRKRERGERAHAEDFDAEEGELIKEENEQE EEIFDQVGEILGTLVKTFKASFLPFFDELSSYLTPMWISGNLLDEGKIRSIVDEIKQVMTASSS RKRERGERAHAEDFDAEEGELIKEENEQEEEIFDQVGEILGTLVKTFKASFLPFFDELSSYLTP MWISGNLLDEGKIRSIVDEIKQVMTASSSRKRERGERAHAEDFDAEEGELIKEENEQEEEIFDQ VGEILGTLVKTFKASFLPFFDELSSYLTPMW(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |