Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0490100_circ_g.1 |
| ID in PlantcircBase | osa_circ_028308 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 24078058-24078158 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0490100 |
| Parent gene annotation |
Similar to 60S ribosomal protein L30. (Os05t0490100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-CC |
| Number of exons covered | Os05t0490100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.172631271 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24078139-24078155(+) |
| Potential amino acid sequence |
MAPTKKASRPFAPPPQKPPRPAALVVVAAAARSRWLPPRRRAAHSRRRRRSHRAPQLSSSSPRP LDHDGSHQEGEPPIRAAAAEATAPRSSRRRRRGRSITMAPTKKA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |