Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0513550_circ_g.2 |
| ID in PlantcircBase | osa_circ_024564 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 25665729-25665981 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0513400 |
| Parent gene annotation |
Similar to Beta-glucosidase. (Os04t0513400-01);Similar to Beta-g lucosidase. (Os04t0513400-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0513400_circ_ag.1 Os04g0513400_circ_ag.2 Os04g0513550_circ_g.1 Os04g0513550_circ_ag.1 Os04g0513550_circ_ag.3 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0513550-00:1 Os04t0513400-02:1 Os04t0513400-01:1 Os04t0513550-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.418927696 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25665770-25665752(+) |
| Potential amino acid sequence |
MREILSSNLPKFTPEEKKLLQNNKVDFIGINHYTAIYAKDCIYSPCTLDTYEGNALVYAIGRRN GKIIGKPVFGSNILW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |