Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0466800_circ_g.1 |
ID in PlantcircBase | osa_circ_028187 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 22909002-22909507 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0466800 |
Parent gene annotation |
Similar to CTD small phosphatase-like protein. (Os05t0466800-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0466800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015566 |
PMCS | 0.248158564 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22909108-22909002(+) 22909457-22909009(+) 22909119-22909503(-) |
Potential amino acid sequence |
MECISAEKDAEGSQRVNRVTVFERPGLHEFLQRTSEFADLILFTAGLEGYAKPLVDRIDAHNRF CHRLYRPSTVTT*(+) MLTTDSVTVSTGHQLLPRSA*(+) MHSMSKQCSPASTASARRAAGRLDDSYAQTRVSSKSSTTW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |