Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0466800_circ_g.1 |
| ID in PlantcircBase | osa_circ_028187 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 22909002-22909507 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0466800 |
| Parent gene annotation |
Similar to CTD small phosphatase-like protein. (Os05t0466800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0466800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015566 |
| PMCS | 0.248158564 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22909108-22909002(+) 22909457-22909009(+) 22909119-22909503(-) |
| Potential amino acid sequence |
MECISAEKDAEGSQRVNRVTVFERPGLHEFLQRTSEFADLILFTAGLEGYAKPLVDRIDAHNRF CHRLYRPSTVTT*(+) MLTTDSVTVSTGHQLLPRSA*(+) MHSMSKQCSPASTASARRAAGRLDDSYAQTRVSSKSSTTW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |