Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0296100_circ_g.4 |
| ID in PlantcircBase | osa_circ_001437 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 10824779-10825051 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0296100 |
| Parent gene annotation |
Similar to Shaggy-related protein kinase alpha (EC 2.7.1.-) (ASK -alpha). (Os01t0296100-01);Similar to Glycogen synthase kinase. (Os01t0296100-02);Similar to Glycogen synthase kinase. (Os01t029 6100-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0296100_circ_g.5 Os01g0296100_circ_g.6 Os01g0296100_circ_g.7 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0296100-01:1 Os01t0296100-02:1 Os01t0296100-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010328 |
| PMCS | 0.568077808 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10824864-10825048(+) |
| Potential amino acid sequence |
MQVLDHPNVACLKHYFCSTTAKEELYLNLVLEYVPETVHRVIRHYNKMSQRMPLIYVKLYMYQA KCLETGERVAVKKVLQDARYKNRELQTMQVLDHPNVACLKHYFCSTTAKEELYLNLVLEYVPET VHRVIRHYNKMSQRMPLIYVKLYMYQAKCLETGERVAVKKVLQDARYKNRELQTMQVLDHPNVA CLKHYFCSTTAKEELYLNLVLEYVPETVHRVIRHYNKMSQRMPLIYVKLYMYQAKCLETGERVA VKKVLQDARYKNRELQTMQVLDHPNVACLKHYFCSTTAKEELYLNLVLEYVPETVHRVIRHYNK MSQRMPLIYVKLYMYQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |