Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0464400_circ_g.3 |
ID in PlantcircBase | osa_circ_039488 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 17602157-17602945 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0464400 |
Parent gene annotation |
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 domain co ntaining protein. (Os09t0464400-00) |
Parent gene strand | - |
Alternative splicing | Os09g0464400_circ_g.1 Os09g0464400_circ_g.2 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0464400-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018546 |
PMCS | 0.147988868 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17602914-17602198(+) 17602931-17602936(-) |
Potential amino acid sequence |
MLADCIVSIAYLISFQRNSQDVWCF*(+) MQSASMKEAKKNGVYGLPEETTLIKCTMCQGSSEQCERILDLTVEIDGDINTLEEALHRFTSTE ILDGDNRYNCSRCKSYERAKKKLTISEAPNILTIALKRYQVCN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |