Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0464400_circ_g.3 |
| ID in PlantcircBase | osa_circ_039488 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 17602157-17602945 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0464400 |
| Parent gene annotation |
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 domain co ntaining protein. (Os09t0464400-00) |
| Parent gene strand | - |
| Alternative splicing | Os09g0464400_circ_g.1 Os09g0464400_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0464400-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018546 |
| PMCS | 0.147988868 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17602914-17602198(+) 17602931-17602936(-) |
| Potential amino acid sequence |
MLADCIVSIAYLISFQRNSQDVWCF*(+) MQSASMKEAKKNGVYGLPEETTLIKCTMCQGSSEQCERILDLTVEIDGDINTLEEALHRFTSTE ILDGDNRYNCSRCKSYERAKKKLTISEAPNILTIALKRYQVCN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |