Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa2G351830_circ_g.3 |
| ID in PlantcircBase | csa_circ_001133 |
| Alias | Chr2:16249521_16252243 |
| Organism | Cucumis sativus |
| Position | chrChr2: 16249521-16252243 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | CIRI2;Find_circ |
| Parent gene | Csa2G351830 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | Csa2G351830_circ_g.1 Csa2G351830_circ_g.2 Csa2G351830_circ_g.4 Csa2G351830_circ_g.5 Csa2G351830_circ_g.6 Csa2G351830_circ_g.7 Csa2G351830_circ_g.8 Csa2G351830_circ_g.9 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa2G351830.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.098210999 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16250466-16249538(+) |
| Potential amino acid sequence |
MEKENLRINSHGNFVSNNLNGRDRTSVDSSLLLRARSEAAVVAVATRPQPTPSEFVLQWGNRKR LRCMKVPVKAKDVSAAAPAHRTTVRVDRRVVRADKDSIIHNHQPTSNHNLNPSNGYLNLRQRPI SPQPPVLPPPPAPSQRILRNSEISGTMRAQSNGGVRAITSPDRAAPEKKPPPSHHDHHHKSAAT SDTKKGGSSSGSGEPTAPPQALPVWPPKFVIALTNKEKEEDFMAIKGSKLPQRPKKRAKIIQRT ININTERF* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019;He et al., 2020 |