Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0278300_circ_g.2 |
| ID in PlantcircBase | osa_circ_019165 |
| Alias | Os_ciR9230 |
| Organism | Oryza sativa |
| Position | chr3: 9451528-9451706 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0278300 |
| Parent gene annotation |
Similar to ALY protein. (Os03t0278300-01);Transcriptional coacti vator-like protein. (Os03t0278300-02);Similar to THO complex sub unit 4. (Os03t0278300-04) |
| Parent gene strand | - |
| Alternative splicing | Os03g0278300_circ_g.1 Os03g0278300_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0278333-00:1 Os03t0278300-02:1 Os03t0278300-04:1 Os03t0278300-01:1 Os03t0278333-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.319470251 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9451621-9451657(-) |
| Potential amino acid sequence |
MKIEILGTNTPTAAAALPANNGGYVRNVAKREQLKLYLQGVAMLSQQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |