Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0754000_circ_g.2 |
| ID in PlantcircBase | osa_circ_016604 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 31709732-31709964 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0754000 |
| Parent gene annotation |
Similar to TLD family protein. (Os02t0754000-01);TLDc domain con taining protein. (Os02t0754000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0754000-01:2 Os02t0754000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186338376 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31709785-31709811(-) |
| Potential amino acid sequence |
MEPQLNRQKLHLLYPQLPVGRYILGLLCKLVKTKQLLLP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |