Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d047717_circ_g.2 |
| ID in PlantcircBase | zma_circ_010055 |
| Alias | zma_circ_0003089 |
| Organism | Zea mays |
| Position | chr9: 139873718-139881066 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d047717 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Zm00001d047717_circ_g.1 Zm00001d047717_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d047717_T022:10 Zm00001d047717_T019:8 Zm00001d047717_T014:10 Zm00001d047717_T010:10 Zm00001d047717_T016:10 Zm00001d047717_T004:10 Zm00001d047717_T023:10 Zm00001d047717_T011:10 Zm00001d047717_T001:10 Zm00001d047717_T030:10 Zm00001d047717_T003:10 Zm00001d047717_T007:10 Zm00001d047717_T006:9 Zm00001d047717_T026:5 Zm00001d047717_T031:10 Zm00001d047717_T028:9 Zm00001d047717_T018:9 Zm00001d047717_T017:10 Zm00001d047717_T025:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.097221263 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
139880794-139881064(-) |
| Potential amino acid sequence |
MKDLFSDETGNYMEAENKYSRAMRGAPADSLFGQFCLHALWFGNCNICAIATLWIDFVREIRWC WEESERLPRMKSTSSIDLSSCLIHQKLQMLTICIERKRSLNREKGTGYKDETSNSTAVNKSRKG SAGVVPKMMLLNTFQEMHAPYTQDAPLMTEDMHEERLHAAEAFGNAIGLSGQLERDILCSDMSA FKAANPDAVFEDFIRWHSPGEWLSEDKTDGNAGWPPKGKLSHRMSQHGNVWRKIWNDALPLPVS EQKSLLDPVREGEKVLHYLETLRPQQLLEQMVCTAFKSSADILNKTMYGGFKEMKTKMDRLYVT MASTLKSFLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | regulating the response to N deficiency |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |