Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d030398_circ_g.2 |
ID in PlantcircBase | zma_circ_006633 |
Alias | zma_circ_0000263 |
Organism | Zea mays |
Position | chr1: 129230101-129246802 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d030398 |
Parent gene annotation |
Pentatricopeptide repeat-containing protein MRL1 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d030398_circ_g.1 Zm00001d030398_circ_g.3 Zm00001d030398_circ_g.4 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d030398_T002:5 Zm00001d030398_T004:5 Zm00001d030398_T006:5 Zm00001d030398_T005:5 Zm00001d030398_T001:5 Zm00001d030398_T003:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.026666103 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
129246760-129246784(-) |
Potential amino acid sequence |
MNILGVHPNEITYSVLFVACERNGEAQLGLDLFEQLKMDGIDINPTIIGSLTGLCLQMFNIDFS LGNIIVNFSSGKPQIDNKWTSSAVMVYREAVSAGLLPSSDVLSQVLGCLRLPHGSSLKSTFIEN MGVSCDIPQYPNINSLFEGFGEYDIRAFSILEEAASLGAVASISIKETRIVIDARKLKIFTAEV MVIRS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |