Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0143500_circ_g.8 |
ID in PlantcircBase | osa_circ_026531 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 2515684-2516383 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0143500 |
Parent gene annotation |
Similar to Mitogen-activated protein kinase 14. (Os05t0143500-01 );Similar to Mitogen-activated protein kinase 14. (Os05t0143500- 02);Similar to Kinase (Fragment). (Os05t0143500-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0143500-02:3 Os05t0143500-03:1 Os05t0143500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_007386* |
PMCS | 0.30154044 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2515960-2515696(+) |
Potential amino acid sequence |
MRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDRPSAEEALADPYFKNIANVDREPSAQPITK LEFEFERRRITKEDIRELIYREILEYHPKMLREFLEGTESTGFMYPSIHQQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |