Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0143500_circ_g.8 |
| ID in PlantcircBase | osa_circ_026531 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2515684-2516383 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0143500 |
| Parent gene annotation |
Similar to Mitogen-activated protein kinase 14. (Os05t0143500-01 );Similar to Mitogen-activated protein kinase 14. (Os05t0143500- 02);Similar to Kinase (Fragment). (Os05t0143500-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0143500-02:3 Os05t0143500-03:1 Os05t0143500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_007386* |
| PMCS | 0.30154044 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2515960-2515696(+) |
| Potential amino acid sequence |
MRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDRPSAEEALADPYFKNIANVDREPSAQPITK LEFEFERRRITKEDIRELIYREILEYHPKMLREFLEGTESTGFMYPSIHQQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |