Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G25980_circ_g.7 |
ID in PlantcircBase | ath_circ_040454 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 9073261-9073483 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G25980 |
Parent gene annotation |
Myrosinase 2 |
Parent gene strand | + |
Alternative splicing | AT5G25980_circ_g.1 AT5G25980_circ_g.2 AT5G25980_circ_g.3 AT5G25980_circ_g.4 AT5G25980_circ_g.5 AT5G25980_circ_g.6 AT5G25980_circ_g.8 AT5G25980_circ_g.9 |
Support reads | 16 |
Tissues | leaf, aerial, inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G25980.3:2 AT5G25980.1:2 AT5G25980.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.18081517 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9073423-9073480(+) |
Potential amino acid sequence |
MEELGVKGYRFSFAWSRILPKKGGADLGNGDTTCDSYRTWQKDLDVMEELGVKGYRFSFAWSRI LPKKGGADLGNGDTTCDSYRTWQKDLDVMEELGVKGYRFSFAWSRILPKKGGADLGNGDTTCDS YRTWQKDLDVMEELGVKGYRFSFAWSRILP(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |