Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0691600_circ_g.7 |
| ID in PlantcircBase | osa_circ_003436 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28551823-28552093 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0691600 |
| Parent gene annotation |
Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01) ;Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM C OMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600 -02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0691600_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0691600-01:1 Os01t0691600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201416298 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28552039-28551901(+) |
| Potential amino acid sequence |
MLVHGVKKLNGWDVFSGQSHVERTRILHQFKNSSDVNTIFLSKVQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |