Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0691600_circ_g.7 |
ID in PlantcircBase | osa_circ_003436 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 28551823-28552093 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0691600 |
Parent gene annotation |
Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01) ;Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM C OMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600 -02) |
Parent gene strand | + |
Alternative splicing | Os01g0691600_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0691600-01:1 Os01t0691600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201416298 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28552039-28551901(+) |
Potential amino acid sequence |
MLVHGVKKLNGWDVFSGQSHVERTRILHQFKNSSDVNTIFLSKVQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |