Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0179100_circ_g.1 |
| ID in PlantcircBase | osa_circ_013468 |
| Alias | Os02circ06129 |
| Organism | Oryza sativa |
| Position | chr2: 4385251-4385361 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0179100 |
| Parent gene annotation |
Metal-dependent phosphohydrolase, HD region domain containing pr otein. (Os02t0179100-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0179100_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0179100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152522147 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4385279-4385358(+) 4385332-4385358(+) |
| Potential amino acid sequence |
MACRRKKRAAESKKHWTICAVCSVVVRELLLVISPLQMACRRKKRAAESKKHWTICAVCSVVVR ELLLVISPLQMACRRKKRAAESKKHWTICAVCSVVVRELLLVISPLQMACRRKKRAAESKKHWT ICAVCSVVVRE(+) MCSLLGGGPRAIVGDITPSDGVPKEEKSRREQEALDHMCSLLGGGPRAIVGDITPSDGVPKEEK SRREQEALDHMCSLLGGGPRAIVGDITPSDGVPKEEKSRREQEALDHMCSLLGGGPR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |