Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0223000_circ_g.4 |
ID in PlantcircBase | osa_circ_023113 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 8223459-8229624 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os04g0223000 |
Parent gene annotation |
Sec1-like protein family protein. (Os04t0223000-01) |
Parent gene strand | - |
Alternative splicing | Os04g0223000_circ_g.3 Os04g0223000_circ_g.5 Os04g0223000_circ_g.6 Os04g0223000_circ_g.7 |
Support reads | 1 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0223000-01:11 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015101 |
PMCS | 0.093159063 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8229559-8223502(+) 8228249-8229593(-) |
Potential amino acid sequence |
MELDTRGTLRVSISDELFPPPESQVVKILLWQPSICK*(+) MQQEDPVNMDDMGTPEINTVILLDREVDLVTPMCSQLTYEGLLDEMLQINNGSVEVDATIMGAQ QDGKKVKVPLNSSDKLYKEIRDLNFEVVVQVLRQKATSIQQDYAEVKSTNTQSVSELKDFVKRL HSLPEIARHVHLAQHLQSFTGKPSFHARLDIEQTILEVQNFEICFEYIEEMIHKQEPIENVLRL LVLLSLTNAGLPKKNFDYLRFWRRKKFIRN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |