Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0223000_circ_g.4 |
| ID in PlantcircBase | osa_circ_023113 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 8223459-8229624 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0223000 |
| Parent gene annotation |
Sec1-like protein family protein. (Os04t0223000-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0223000_circ_g.3 Os04g0223000_circ_g.5 Os04g0223000_circ_g.6 Os04g0223000_circ_g.7 |
| Support reads | 1 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0223000-01:11 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015101 |
| PMCS | 0.093159063 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8229559-8223502(+) 8228249-8229593(-) |
| Potential amino acid sequence |
MELDTRGTLRVSISDELFPPPESQVVKILLWQPSICK*(+) MQQEDPVNMDDMGTPEINTVILLDREVDLVTPMCSQLTYEGLLDEMLQINNGSVEVDATIMGAQ QDGKKVKVPLNSSDKLYKEIRDLNFEVVVQVLRQKATSIQQDYAEVKSTNTQSVSELKDFVKRL HSLPEIARHVHLAQHLQSFTGKPSFHARLDIEQTILEVQNFEICFEYIEEMIHKQEPIENVLRL LVLLSLTNAGLPKKNFDYLRFWRRKKFIRN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |