Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G29320_circ_g.3 |
| ID in PlantcircBase | ath_circ_024320 |
| Alias | At_ciR688, AT3G29320_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 11253544-11253982 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT3G29320 |
| Parent gene annotation |
Alpha-glucan phosphorylase 1 |
| Parent gene strand | + |
| Alternative splicing | 3_circ_igg.2 AT3G29320_circ_g.1 AT3G29320_circ_g.2 AT3G29320_circ_g.4 AT3G29320_circ_g.5 |
| Support reads | 15/4 |
| Tissues | leaf/seedlings |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G29320.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.382360966 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11253869-11253979(+) |
| Potential amino acid sequence |
MATLNYPAWGYGLRYKYGLFKQRITKDGQEEAAEDWLEGRALSNAVGNLGLNSAYGDALKRLGF DLESVASQEPDPALGNGGLGRLASCFLDSMATLNYPAWGYGLRYKYGLFKQRITKDGQEEAAED WLEGRALSNAVGNLGLNSAYGDALKRLGFDLESVASQEPDPALGNGGLGRLASCFLDSMATLNY PAWGYGLRYKYGLFKQRITKDGQEEAAEDWLEGRALSNAVGNLGLNSAYGDALKRLGFDLESVA SQEPDPALGNGGLGRLASCFLDSMATLNYPAWGYGLRYKYGLFKQRITKDGQEEAAEDWLE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress; responsive to heat stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Pan et al., 2017;Zhang et al., 2019 |