Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0793300_circ_g.1 |
ID in PlantcircBase | osa_circ_016887 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 33711341-33713224 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0793300 |
Parent gene annotation |
Similar to Nudix hydrolase 3 (EC 3.6.1.-) (AtNUDT3). Splice isof orm 2. (Os02t0793300-01) |
Parent gene strand | + |
Alternative splicing | Os02g0793300_circ_g.2 Os02g0793300_circ_g.3 Os02g0793300_circ_g.4 Os02g0793300_circ_g.5 Os02g0793300_circ_g.6 Os02g0793300_circ_g.7 Os02g0793300_circ_g.8 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0793300-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.109215344 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33711741-33711370(+) 33713206-33711370(+) |
Potential amino acid sequence |
MHLDEYKSCLAKESGEYVPYDVNGTYGQLFSIIEERYKDNIESRSLTLQKQINRYAPIHLEPEL TSLSEGDREALGYILKASIVIDDIFYEQCYQQWHIHQQ*(+) MTSFMSSVINNGTYTNNEYNDVYLVTTLTPIPLEAFTLQESEVSAVRYMHLDEYKSCLAKESGE YVPYDVNGTYGQLFSIIEERYKDNIESRSLTLQKQINRYAPIHLEPELTSLSEGDREALGYILK ASIVIDDIFYEQCYQQWHIHQQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |