Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G26570_circ_g.8 |
| ID in PlantcircBase | ath_circ_040562 |
| Alias | AT5G26570_C1, AT5G26570_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 9266154-9266352 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G26570 |
| Parent gene annotation |
Phosphoglucan, water dikinase, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT5G26570_circ_g.4 AT5G26570_circ_g.5 AT5G26570_circ_g.6 AT5G26570_circ_g.7 AT5G26570_circ_g.9 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G26570.2:1 AT5G26570.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.387498894 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9266295-9266195(+) |
| Potential amino acid sequence |
MMKNQSLVPHLPIASFTLPRLEASPSHVNLILSTEGRSRTSKSSATKKTDKNSLSKKKTDKKSL SIDDEESKPGSSSSNSLLYSSKVGSISKSCESDTFN* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |