Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0117300_circ_g.1 |
| ID in PlantcircBase | osa_circ_035655 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 963987-964315 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os08g0117300 |
| Parent gene annotation |
Similar to 40S ribosomal protein S13. (Os08t0117300-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0117200_circ_ag.1 Os08g0117200_circ_ag.2 |
| Support reads | 14 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0117300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.706178618 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
964110-963995(+) 964118-964115(-) |
| Potential amino acid sequence |
MIISSTSEAAVLSQLGGVLLYGSADDEIPFRGP*(+) MIMKAAKKGQMPSQIGVVLRDQHGIPLVKSVTGSKILRILKAHGRVSRRRRCRTRGLPRAGSRP PPPMWRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |