Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0117300_circ_g.1 |
ID in PlantcircBase | osa_circ_035655 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 963987-964315 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os08g0117300 |
Parent gene annotation |
Similar to 40S ribosomal protein S13. (Os08t0117300-01) |
Parent gene strand | - |
Alternative splicing | Os08g0117200_circ_ag.1 Os08g0117200_circ_ag.2 |
Support reads | 14 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0117300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.706178618 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
964110-963995(+) 964118-964115(-) |
Potential amino acid sequence |
MIISSTSEAAVLSQLGGVLLYGSADDEIPFRGP*(+) MIMKAAKKGQMPSQIGVVLRDQHGIPLVKSVTGSKILRILKAHGRVSRRRRCRTRGLPRAGSRP PPPMWRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |