Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G55080_circ_g.3 |
| ID in PlantcircBase | ath_circ_027607 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 20414769-20415385 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G55080 |
| Parent gene annotation |
At3g55080 |
| Parent gene strand | - |
| Alternative splicing | AT3G55080_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G55080.4:1 AT3G55080.1:2 AT3G55080.2:1 AT3G55080.5:2 AT3G55080.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119940046 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20414793-20414771(-) |
| Potential amino acid sequence |
MLKVPFNAASLDNNFLPWLERIAGAKITNTLSIGKSTYGRSLFASKVIYAGDCMLKVPFNAASL DNNFLPWLERIAGAKITNTLSIGKSTYGRSLFASKVIYAGDCMLKVPFNAASLDNNFLPWLERI AGAKITNTLSIGKSTYGRSLFASKVIYAGDCMLKVPFNA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |