Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G64110_circ_g.2 |
ID in PlantcircBase | ath_circ_008599 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 23799917-23800325 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G64110 |
Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G64110.1:3 AT1G64110.2:3 AT1G64110.5:3 AT1G64110.4:3 AT1G64110.3:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.190473227 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23800312-23799919(-) |
Potential amino acid sequence |
MLAKALAHFFDAKLLLLDVNDFALKIQSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQ REESKELYQQMLAKALAHFFDAKLLLLDVNDFALKIQSKYGSGNTESSSFKRSPSESALEQLSG LFSSFSILPQREESKELYQQMLAKALAHFFDAKLLLLDVNDFALKIQSKYGSGNTESSSFKRSP SESALEQLSGLFSSFSILPQREESKELYQQMLAKALAHFFDAKLLLLDVNDFALKIQSKYGSGN TESSSFKRSPSESALEQLSGLFSSFSILPQREESK(-) |
Sponge-miRNAs | ath-miR835-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |