Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0738400_circ_g.24 |
| ID in PlantcircBase | osa_circ_021792 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30301904-30302101 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0738400 |
| Parent gene annotation |
Similar to Serine hydroxymethyltransferase, cytosolic (EC 2.1.2. 1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT). (Os03t0738400-01);Similar to Serine hydroxymethyltransferase. ( Os03t0738400-02);Similar to Serine hydroxymethyltransferase. (Os 03t0738400-03) |
| Parent gene strand | + |
| Alternative splicing | Os03g0738400_circ_g.13 Os03g0738400_circ_g.14 Os03g0738400_circ_g.15 Os03g0738400_circ_g.16 Os03g0738400_circ_g.17 Os03g0738400_circ_g.18 Os03g0738400_circ_g.19 Os03g0738400_circ_g.20 Os03g0738400_circ_g.21 Os03g0738400_circ_g.22 Os03g0738400_circ_g.23 Os03g0738400_circ_g.25 Os03g0738400_circ_g.26 Os03g0738400_circ_g.27 Os03g0738400_circ_g.28 Os03g0738400_circ_g.29 Os03g0738400_circ_g.30 Os03g0738400_circ_g.31 Os03g0738400_circ_g.32 Os03g0738400_circ_g.33 Os03g0738400_circ_g.34 Os03g0738400_circ_g.35 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0738400-03:1 Os03t0738400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.526841667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30301941-30302098(+) |
| Potential amino acid sequence |
MAHISGLVAAGVVPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVCDKQKAILL ADMAHISGLVAAGVVPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVCDKQKAI LLADMAHISGLVAAGVVPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVCDKQK AILLADMAHISGLVAAGVVPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |