Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0511600_circ_g.5 |
| ID in PlantcircBase | osa_circ_039792 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 19885302-19885875 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0511600 |
| Parent gene annotation |
Glycoside hydrolase, family 1 protein. (Os09t0511600-01);Non-pro tein coding transcript. (Os09t0511600-02);Glycoside hydrolase, f amily 1 protein. (Os09t0511600-03);Glycoside hydrolase, family 1 protein. (Os09t0511600-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0511600-03:4 Os09t0511600-01:4 Os09t0511600-04:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.17463583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19885520-19885873(-) 19885306-19885873(-) |
| Potential amino acid sequence |
MGVDAYRMSISWSRLIPDGRGAVNPKGLEYYNNLIDELLSHG*(-) MVEGAFAEDGRKPSIWDTFSHSGYSVDGATGDVTADQYHKYKANVKLLQDMGVDAYRMSISWSR LIPDGRGAVNPKGLEYYNNLIDELLSHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |