Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0182200_circ_g.7 |
ID in PlantcircBase | osa_circ_013508 |
Alias | Os_ciR8288 |
Organism | Oryza sativa |
Position | chr2: 4576091-4576660 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0182100 |
Parent gene annotation |
B-type response regulator, Cytokinin signaling (Os02t0182100-01) |
Parent gene strand | - |
Alternative splicing | Os02g0182200_circ_g.8 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0182200-00:2 Os02t0182100-01:2 Os02t0182200-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003702* |
PMCS | 0.29279402 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4576112-4576602(-) 4576630-4576627(-) |
Potential amino acid sequence |
MLLVICSVVCERGNTNCHEGYNPWCM*(-) MKGITHGACDYLLKPVRLEQLRTIWQHVIRRKNCDAKNRGNDDDAGQKAQGMNNEGESIGANRN KRQSRKSRDENGDDGDDSDENSNENGDSSTQKKPRVVWSVELHRKFVAAVNQLGIEKAVPKKIL DLMNVENITRENVASHLQCCLRTGKHKLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |