Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0182200_circ_g.7 |
| ID in PlantcircBase | osa_circ_013508 |
| Alias | Os_ciR8288 |
| Organism | Oryza sativa |
| Position | chr2: 4576091-4576660 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0182100 |
| Parent gene annotation |
B-type response regulator, Cytokinin signaling (Os02t0182100-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0182200_circ_g.8 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0182200-00:2 Os02t0182100-01:2 Os02t0182200-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003702* |
| PMCS | 0.29279402 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4576112-4576602(-) 4576630-4576627(-) |
| Potential amino acid sequence |
MLLVICSVVCERGNTNCHEGYNPWCM*(-) MKGITHGACDYLLKPVRLEQLRTIWQHVIRRKNCDAKNRGNDDDAGQKAQGMNNEGESIGANRN KRQSRKSRDENGDDGDDSDENSNENGDSSTQKKPRVVWSVELHRKFVAAVNQLGIEKAVPKKIL DLMNVENITRENVASHLQCCLRTGKHKLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |