Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G58080_circ_g.3 |
| ID in PlantcircBase | ath_circ_007882 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 21505041-21505121 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, CIRI-full |
| Parent gene | AT1G58080 |
| Parent gene annotation |
HISN1A |
| Parent gene strand | - |
| Alternative splicing | AT1G58080_circ_g.1 AT1G58080_circ_g.2 AT1G58080_circ_g.4 AT1G58080_circ_g.5 AT1G58080_circ_g.6 AT1G58080_circ_g.7 AT1G58080_circ_g.8 AT1G58080_circ_g.9 AT1G58080_circ_g.10 |
| Support reads | 1 |
| Tissues | aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G58080.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.205760598 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21505110-21505043(-) 21505055-21505118(+) |
| Potential amino acid sequence |
MRGNSAQEVAERVLSQPSLSGLQVVANMRGNSAQEVAERVLSQPSLSGLQVVANMRGNSAQEVA ERVLSQPSLSGLQVVANMRGNSAQEVAERVLSQPSLSGLQ(-) MMVGSAHAQPLPEHYFLSCLQQPAILTMMVGSAHAQPLPEHYFLSCLQQPAILTMMVGSAHAQP LPEHYFLSCLQQPAILTMMVGSAHAQPLPEHYFLSCLQQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |