Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d052723_circ_g.1 |
ID in PlantcircBase | zma_circ_008202 |
Alias | zma_circ_0001639 |
Organism | Zea mays |
Position | chr4: 198877258-198877758 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d052723 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Zm00001d052723_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d052723_T017:2 Zm00001d052723_T010:2 Zm00001d052723_T013:2 Zm00001d052723_T002:2 Zm00001d052723_T005:1 Zm00001d052723_T004:1 Zm00001d052723_T003:1 Zm00001d052723_T009:2 Zm00001d052723_T015:2 Zm00001d052723_T007:2 Zm00001d052723_T020:2 Zm00001d052723_T006:2 Zm00001d052723_T008:2 Zm00001d052723_T014:2 Zm00001d052723_T016:2 Zm00001d052723_T019:1 Zm00001d052723_T011:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.171161477 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
198877709-198877380(+) 198877337-198877434(-) 198877315-198877670(-) |
Potential amino acid sequence |
MLSRLRFRLLVRCSSFNLWTTSHKIIKLPILLLIIMPVKRSQHFPKPIWQLKEKLHKS*(+) MLAPLHWHDYKKQYGKLDDFVASRPEVERAASDKQSEPQSRQHKPSNFPPTTQLNLKNSATENP NVVNQVDTMKSVTGGFGSQLPRVPKEPALLDERSLLACIVRAVPAGPEGGIRISSTVSQFSSTL RCYGRD*(-) MIIRSNMGSLMILWLVVQRLKELHLTSNLNLNLDSINLQTSLQLPSLT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |