Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0670800_circ_g.2 |
ID in PlantcircBase | osa_circ_025887 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 34218060-34219638 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0670800 |
Parent gene annotation |
UBX domain containing protein. (Os04t0670800-01);UBX domain cont aining protein. (Os04t0670800-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0670800-02:5 Os04t0670800-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014994 |
PMCS | 0.127393387 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34218200-34218196(+) 34219577-34218068(+) |
Potential amino acid sequence |
MFNGPFDKAKLEASVLDKWLLINLQSTEEFSSHMLNRDTWANEAVAQTIRSNFIFWQVYHDTSE GRKVCTYYNLVSVPAILLIDPITGQKMRGWNGMIHPDRLLEDLMPYLDKGPKEHHAAQPQKRPR KVDQETSIGKQAFGLIQQLHFVTLKRSQGNLLFGILSRMLHLVLVIIWRHCIVHHLL*(+) MQLNLKNGQEKLIRKLLSANKRSA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |