Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0258400_circ_g.3 |
ID in PlantcircBase | osa_circ_033346 |
Alias | Os_ciR5590 |
Organism | Oryza sativa |
Position | chr7: 8968062-8968534 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup, find_circ |
Parent gene | Os07g0258400 |
Parent gene annotation |
OsNramp1 (Integral membrane protein). (Os07t0258400-01);Similar to Metal transporter. (Os07t0258400-02);Integral membrane protei n, Metal ion transport (Os07t0258400-03) |
Parent gene strand | + |
Alternative splicing | Os07g0258400_circ_g.1 Os07g0258400_circ_g.2 Os07g0258400_circ_g.4 Os07g0258400_circ_g.5 Os07g0258400_circ_g.6 Os07g0258400_circ_g.7 Os07g0258400_circ_g.8 Os07g0258400_circ_g.9 Os07g0258400_circ_g.10 Os07g0258400_circ_g.11 Os07g0258400_circ_g.12 |
Support reads | 3/3/7 |
Tissues | root/root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0258400-01:2 Os07t0258400-02:2 Os07t0258400-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017686 |
PMCS | 0.390637182 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8968396-8968134(+) 8968428-8968463(-) |
Potential amino acid sequence |
MAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSIALLGALVMPYRYRICFQPFVPHTSVD RGSHCWL*(+) MLISTKKHPAMTNTNSATTTSSFLTPYLCSPRRRSVLEPAMRTPVHTGMWNKRLKANPVPIRHY KSPKKGNGVSCGTGPTEPGDE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |