Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0974000_circ_g.2 |
| ID in PlantcircBase | osa_circ_006035 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 43043231-43043321 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0974000 |
| Parent gene annotation |
Mammalian cell entry related domain containing protein. (Os01t09 74000-01);Mammalian cell entry related domain containing protein . (Os01t0974000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0974000-02:1 Os01t0974000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.456734707 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43043248-43043257(+) 43043250-43043304(-) |
| Potential amino acid sequence |
MLTPENTDLIKQSIFTLIFTLKNIEKAEVFHAYP*(+) MEDFSLLNILQSKDKGENRLLNKIGVLRGKHGRLQPSQYSSE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |