Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G04490_circ_g.8 |
ID in PlantcircBase | ath_circ_019667 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 1207837-1207968 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT3G04490 |
Parent gene annotation |
Exportin-4 protein |
Parent gene strand | + |
Alternative splicing | AT3G04490_circ_g.5 AT3G04490_circ_g.6 AT3G04490_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G04490.1:1 AT3G04490.2:1 AT3G04490.4:1 AT3G04490.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.274648723 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1207912-1207965(+) |
Potential amino acid sequence |
MGLSVMNPVLRLLEVYKHEVSCVLERLRGAASATEPRTQRAIYEMGLSVMNPVLRLLEVYKHEV SCVLERLRGAASATEPRTQRAIYEMGLSVMNPVLRLLEVYKHEVSCVLERLRGAASATEPRTQR AIYEMGLSVMNPVLRLLEVYKHE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |