Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G17700_circ_g.3 |
| ID in PlantcircBase | ath_circ_022429 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 6051322-6051399 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G17700 |
| Parent gene annotation |
Probable cyclic nucleotide-gated ion channel 20, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | 3_circ_ag.2 AT3G17700_circ_g.1 AT3G17700_circ_g.2 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G17700.2:1 AT3G17700.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.213679167 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6051332-6051396(+) 6051374-6051324(-) |
| Potential amino acid sequence |
MTLRRRDVEQWMSHRRLPDGIRRNLEMTLRRRDVEQWMSHRRLPDGIRRNLEMTLRRRDVEQWM SHRRLPDGIRRNLEMTLRRRDVEQWMSHRRLPDGIR(+) MAHPLLHITPSQRHFQIPSYTIWQPSMAHPLLHITPSQRHFQIPSYTIWQPSMAHPLLHITPSQ RHFQIPSYTIWQPSMAHPLLHITPSQRHFQI(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |