Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0143700_circ_g.2 |
| ID in PlantcircBase | osa_circ_035825 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 2415587-2416586 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0143700 |
| Parent gene annotation |
Protein of unknown function DUF676, hydrolase-like domain contai ning protein. (Os08t0143700-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0143700_circ_g.1 Os08g0143700_circ_g.3 Os08g0143700_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0143700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.249153392 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2416426-2416585(-) 2415655-2416551(-) |
| Potential amino acid sequence |
MNFITVATPHLGSRGNNQVPLLFGSIAMENFASRVVHWIFRRTGKHLFLTDDDEGEPPLLQRMA EDYGDLYFM*(-) MMMRENHHYCSAWLKIMVIFISCDRCNHSKARTH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |