Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014572_circ_g.7 |
| ID in PlantcircBase | zma_circ_008489 |
| Alias | zma_circ_0002118 |
| Organism | Zea mays |
| Position | chr5: 53962212-53962617 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d014572 |
| Parent gene annotation |
Probable 2-oxoglutarate-dependent dioxygenase DIN11 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d014572_circ_g.1 Zm00001d014572_circ_g.2 Zm00001d014572_circ_g.3 Zm00001d014572_circ_g.4 Zm00001d014572_circ_g.5 Zm00001d014572_circ_g.6 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d014572_T003:3 Zm00001d014572_T007:3 Zm00001d014572_T006:3 Zm00001d014572_T004:3 Zm00001d014572_T002:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.158381445 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53962610-53962274(+) 53962373-53962603(-) 53962216-53962213(-) |
| Potential amino acid sequence |
MAFHKLDPSIGLARSPYLPGLIGV*(+) MKQSIVILLLDLANMEISLNQWKDLTYERPWY*(-) MKGHGIDESLMREVRNVTREFFQLPYEEKLKIKMTPQSGYRGYQRIGENITKGKPDMHEAIDCY TPIRPGKYGDLAKPMEGSNL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |