Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G240100_circ_g.1 |
| ID in PlantcircBase | gra_circ_001253 |
| Alias | Chr11:56497043|56497621 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 56497043-56497621 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G240100 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.011G240100_circ_ag.1 orai.011G240100_circ_ag.2 orai.011G240100_circ_ag.3 |
| Support reads | 193/89 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.011G240100.2:3 Gorai.011G240100.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.075295351 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
56497078-56497560(-) 56497598-56497502(+) |
| Potential amino acid sequence |
MYLYQILITENKDTSSWEHIWKLFPCYNIWRI*(-) MCSQLLVSLFSVISIWYKYMYWCSSSHSFRNSRIYSACVCLFPWGSNTALTRPPSVKITLQISF *(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |