Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g071730.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_000671 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr2: 41094983-41099225 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g071730.2 |
| Parent gene annotation |
Floral homeotic protein AGAMOUS |
| Parent gene strand | - |
| Alternative splicing | Solyc02g071730.2_circ_g.1 Solyc02g071730.2_circ_g.3 |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc02g071730.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149389966 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41099219-41099219(-) |
| Potential amino acid sequence |
MDFQSDLTREISPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVF SNRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNLMNQNRNMM GEALAGMKLKELKNLEQRIEKGISKIRSKKVK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |