Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0611300_circ_g.1 |
| ID in PlantcircBase | osa_circ_015463 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 24050282-24050631 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0611300 |
| Parent gene annotation |
Zinc finger, PHD-type domain containing protein. (Os02t0611300-0 1) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0611300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011995 zma_circ_008100* zma_circ_001725 |
| PMCS | 0.561029571 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24050293-24050624(-) 24050595-24050624(-) |
| Potential amino acid sequence |
MTTVINDATCEQRLWDMKRRGDKNFYMCEISKDFTIDATFKGNTSRFLNHSCDPNCKLEKWQVD GETRVGVFASRSIQVGEHLTYDYSHQ*(-) MKRRGDKNFYMCEISKDFTIDATFKGNTSRFLNHSCDPNCKLEKWQVDGETRVGVFASRSIQVG EHLTYDYSHQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |