Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0611300_circ_g.1 |
ID in PlantcircBase | osa_circ_015463 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 24050282-24050631 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0611300 |
Parent gene annotation |
Zinc finger, PHD-type domain containing protein. (Os02t0611300-0 1) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0611300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011995 zma_circ_008100* zma_circ_001725 |
PMCS | 0.561029571 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24050293-24050624(-) 24050595-24050624(-) |
Potential amino acid sequence |
MTTVINDATCEQRLWDMKRRGDKNFYMCEISKDFTIDATFKGNTSRFLNHSCDPNCKLEKWQVD GETRVGVFASRSIQVGEHLTYDYSHQ*(-) MKRRGDKNFYMCEISKDFTIDATFKGNTSRFLNHSCDPNCKLEKWQVDGETRVGVFASRSIQVG EHLTYDYSHQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |