Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0783650_circ_g.2 |
ID in PlantcircBase | osa_circ_016835 |
Alias | Os_ciR8154 |
Organism | Oryza sativa |
Position | chr2: 33262014-33263168 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0783700 |
Parent gene annotation |
Similar to Lysine ketoglutarate reductase/saccharopine dehydroge nase. (Os02t0783700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0783650-01:3 Os02t0783650-01:3 Os02t0783700-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012382 |
PMCS | 0.127788312 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33263149-33262645(+) 33263092-33262146(-) |
Potential amino acid sequence |
MLRQTSSLKKGLSIEVLLFTNSMEPPMSQVISEIPTKGQPFFISCCNWSMLSNRGNLLSQYMQL TMADAYGAILS*(+) MVTPKDPTRCFNKADYYAHPEHYKPVFHERIAPYASAIVNCMYWERRFPRLLSIDQLQQLMKNG CPLVGISDITCDIGGSIEFVNKSTSIERPFFRLEVCLNIHNQAREYSSCMVVLSLLETWSLPRI PPDASTKLTIMLIQNTTSLFFMKGLLHMHLPLLTACTGRGGFHDY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |