Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0783650_circ_g.2 |
| ID in PlantcircBase | osa_circ_016835 |
| Alias | Os_ciR8154 |
| Organism | Oryza sativa |
| Position | chr2: 33262014-33263168 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0783700 |
| Parent gene annotation |
Similar to Lysine ketoglutarate reductase/saccharopine dehydroge nase. (Os02t0783700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0783650-01:3 Os02t0783650-01:3 Os02t0783700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012382 |
| PMCS | 0.127788312 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33263149-33262645(+) 33263092-33262146(-) |
| Potential amino acid sequence |
MLRQTSSLKKGLSIEVLLFTNSMEPPMSQVISEIPTKGQPFFISCCNWSMLSNRGNLLSQYMQL TMADAYGAILS*(+) MVTPKDPTRCFNKADYYAHPEHYKPVFHERIAPYASAIVNCMYWERRFPRLLSIDQLQQLMKNG CPLVGISDITCDIGGSIEFVNKSTSIERPFFRLEVCLNIHNQAREYSSCMVVLSLLETWSLPRI PPDASTKLTIMLIQNTTSLFFMKGLLHMHLPLLTACTGRGGFHDY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |