Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0916950_circ_g.2 |
| ID in PlantcircBase | osa_circ_005482 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 39967383-39968333 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0916950 |
| Parent gene annotation |
Hypothetical gene. (Os01t0916950-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0916800-00:5 Os01t0916950-00:5 Os01t0916800-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.180391027 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39968317-39968314(-) |
| Potential amino acid sequence |
MITPVVDAFKYLTQLEFDILQYIVIERLAQGGREKLKDDGLNLSDWLQCLASFWGHLCKKHHSV ELRSLFQYLVNQLKKDTGIELVVLEELIQQMANVQYTENMTEEQVDAMAGSETLRLQASSLFGS TRNSKVLTKSTNKLRDSLLPKEEPKLAIPLLLLIAQHRSKLKHIGT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |