Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G01310_circ_g.8 |
| ID in PlantcircBase | ath_circ_019056 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 97609-97767 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G01310 |
| Parent gene annotation |
Phosphoglycerate mutase-like family protein |
| Parent gene strand | - |
| Alternative splicing | AT3G01310_circ_g.7 AT3G01310_circ_g.9 AT3G01310_circ_g.10 AT3G01310_circ_g.11 AT3G01310_circ_g.12 AT3G01310_circ_g.13 AT3G01310_circ_g.14 AT3G01310_circ_g.15 AT3G01310_circ_g.16 AT3G01310_circ_g.17 AT3G01310_circ_g.18 AT3G01310_circ_g.19 AT3G01310_circ_g.20 |
| Support reads | 24 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G01310.1:1 AT3G01310.2:1 AT3G01310.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.344182246 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
97657-97611(-) |
| Potential amino acid sequence |
MVLKYGGVLTHAGRKQGGHFSGIYRKVQLKPLKWVKIPKSDGDGEEERPVEALMVLKYGGVLTH AGRKQGGHFSGIYRKVQLKPLKWVKIPKSDGDGEEERPVEALMVLKYGGVLTHAGRKQGGHFSG IYRKVQLKPLKWVKIPKSDGDGEEERPVEALMVLKYGGVLTHAGRKQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |