Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0794900_circ_g.9 |
| ID in PlantcircBase | osa_circ_016926 |
| Alias | Os_ciR8176 |
| Organism | Oryza sativa |
| Position | chr2: 33790715-33790835 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0794900 |
| Parent gene annotation |
Formin-like protein 7. (Os02t0794900-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0794900-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.278267287 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33790777-33790832(+) 33790788-33790808(-) |
| Potential amino acid sequence |
MFGMATEKRLSSSEISISGVQKNFFLFRCNRRTLACPFLLHVWHGYREKTFKFRNIYLWGSKEL FLVSLQQKDVGVPVSPPCLAWLPRKDFQVPKYLSLGFKRTFSCFAATEGRWRARFSSMFGMATE KRLSSSEISISGV(+) MPNMEEKRARQRPSVAAKQEKVLLNPRDRYFGT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |