Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0870300_circ_g.1 |
ID in PlantcircBase | osa_circ_005004 |
Alias | Os_ciR6301 |
Organism | Oryza sativa |
Position | chr1: 37728681-37733020 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os01g0870300 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0870300-01);Ammonium transpor ter. (Os01t0870300-02) |
Parent gene strand | + |
Alternative splicing | Os01g0870300_circ_igg.1 Os01g0870300_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0870300-02:6 Os01t0870300-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.091757836 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37732975-37728699(+) 37728767-37732985(-) |
Potential amino acid sequence |
MGELKDIMLQSHQFIRLHKSNK*(+) MHSENSVFSEKLFVAPSFANSSFVGFVEPDKLVTLKHYIF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |