Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0870300_circ_g.1 |
| ID in PlantcircBase | osa_circ_005004 |
| Alias | Os_ciR6301 |
| Organism | Oryza sativa |
| Position | chr1: 37728681-37733020 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0870300 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0870300-01);Ammonium transpor ter. (Os01t0870300-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0870300_circ_igg.1 Os01g0870300_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0870300-02:6 Os01t0870300-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.091757836 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37732975-37728699(+) 37728767-37732985(-) |
| Potential amino acid sequence |
MGELKDIMLQSHQFIRLHKSNK*(+) MHSENSVFSEKLFVAPSFANSSFVGFVEPDKLVTLKHYIF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |