Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d039349_circ_g.4 |
| ID in PlantcircBase | zma_circ_007464 |
| Alias | zma_circ_0001419 |
| Organism | Zea mays |
| Position | chr3: 2355618-2355783 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d039349 |
| Parent gene annotation |
Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d039349_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d039349_T002:1 Zm00001d039349_T004:1 Zm00001d039349_T001:1 Zm00001d039349_T003:1 Zm00001d039349_T005:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257031627 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2355781-2355618(+) 2355633-2355618(+) |
| Potential amino acid sequence |
MISNLPMGYPVLQQPIMPAPGQPHMDPMACGLSSGHVVNGIPAPGGYHPMRMNSGND*(+) MGYPVLQQPIMPAPGQPHMDPMACGLSSGHVVNGIPAPGGYHPMRMNSGND*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |