Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g060230.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001975 |
| Alias | 6:34578271|34578548 |
| Organism | Solanum lycopersicum |
| Position | chr6: 38188371-38188648 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc06g060230.2 |
| Parent gene annotation |
Nam-like protein 1 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc06g060230.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.980205875 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38188435-38188417(-) |
| Potential amino acid sequence |
MHEYRLADVDRSARKNNNSLRIWHCMEKRSGTSFHLEIGSIRMVHDLIELLELDIGRLLVRISR LEIRKRWELRKHWCFILVKHLKERKLIGSCMNIV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |