Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d021516_circ_g.3 |
ID in PlantcircBase | zma_circ_009418 |
Alias | Zm07circ00077, zma_circ_0002469, GRMZM2G032336_C1 |
Organism | Zea mays |
Position | chr7: 154829865-154830875 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d021516 |
Parent gene annotation |
Calmodulin-binding transcription activator 5 |
Parent gene strand | - |
Alternative splicing | Zm00001d021516_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d021516_T004:3 Zm00001d021516_T013:3 Zm00001d021516_T002:3 Zm00001d021516_T014:3 Zm00001d021516_T001:3 Zm00001d021516_T007:3 Zm00001d021516_T003:3 Zm00001d021516_T010:3 Zm00001d021516_T011:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.183354011 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
154829871-154830598(+) 154830674-154830856(-) |
Potential amino acid sequence |
MFDDNARGQCAPTLCQVASSICERNLDHPLLEHNTHEPFLHYQSLVFHGLLGQSCHLSFSSSYG HLYGSSGQLYDHIEQQYHLRCLTIMHEDNALQLFVK*(+) MKKRFMCIMLEERMIQISFADATGYLTKSWSALSSCIIVKHLRWYCCSI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |