Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0467100_circ_g.3 |
ID in PlantcircBase | osa_circ_039503 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 17743849-17745822 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0467100 |
Parent gene annotation |
ATP-grasp fold, subdomain 2 domain containing protein. (Os09t046 7100-01) |
Parent gene strand | + |
Alternative splicing | Os09g0467100_circ_g.1 Os09g0467100_circ_g.2 Os09g0467100_circ_g.4 Os09g0467100_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0467100-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.115802415 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17744017-17743873(+) |
Potential amino acid sequence |
MVKNQKLSANILTPTTKAADHDVPVTPEEIINSGLMSKEDFDEARSKALSLFAYGQEVALENGL ILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEERFSSGLEPENVDKEFLRLWFKNNCN PYEDAVLPEAPEELVCELAWREGICYWKH*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |