Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0370800_circ_g.2 |
| ID in PlantcircBase | osa_circ_006637 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 11699686-11700691 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0370800 |
| Parent gene annotation |
Similar to Exo-1,3-beta-glucanase precursor (EC 3.2.1.58) (Fragm ent). (Os10t0370800-01);Similar to cellulase containing protein. (Os10t0370800-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0370800_circ_g.1 Os10g0370800_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0370800-02:3 Os10t0370800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.317593583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11700677-11699810(+) 11700649-11699776(+) 11699901-11700668(-) |
| Potential amino acid sequence |
MCSNVPTNVRGLFCFVMLLNSALRLFFTNSMFCSTFKFLNVSSLNRL*(+) MNSKSLSTMYVLQCSNKRERALLLRDVAELSLAAVLHKFNVLLYV*(+) MSNRLAGESNTELLDFASRFPGVVIDVHYYNLFNDDTFKNLNVEQNIEFVKNSRKAEFSNITKQ KSPLTFVGTLEHIHS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |