Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G73670_circ_g.1 |
ID in PlantcircBase | ath_circ_010036 |
Alias | At_ciR2262 |
Organism | Arabidpsis thaliana |
Position | chr1: 27701506-27701655 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT1G73670 |
Parent gene annotation |
Mitogen-activated protein kinase 15 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G73670.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.465397164 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27701554-27701652(+) |
Potential amino acid sequence |
MLLGKPLFPGKNVVHQLDIMTDFLGTPPPEAISKYTPAIDIWSVGCIFAEMLLGKPLFPGKNVV HQLDIMTDFLGTPPPEAISKYTPAIDIWSVGCIFAEMLLGKPLFPGKNVVHQLDIMTDFLGTPP PEAISKYTPAIDIWSVGCIFAEMLLGKPLFPGKNVVHQLDIMTDFLGTPPPEAISK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |